PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0103s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 300aa    MW: 33956.3 Da    PI: 6.2767
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0103s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.67.8e-171773157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          r++R++ ++ qle Le+++++n+yps + r+ L+k++gL+e+q +vWF  rR k+++
  Sphfalx0103s0009.1.p 17 RSSRQKKSTFQLELLEKVYAENKYPSIAFRAGLTKEVGLSEKQLQVWFTHRRRKDRR 73
                          6789***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-18373IPR009057Homeodomain-like
SuperFamilySSF466897.7E-17573IPR009057Homeodomain-like
PROSITE profilePS5007116.7141474IPR001356Homeobox domain
SMARTSM003892.3E-151678IPR001356Homeobox domain
PfamPF000463.5E-141773IPR001356Homeobox domain
CDDcd000861.44E-141773No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MASDDSSPGA SPEQQKRSSR QKKSTFQLEL LEKVYAENKY PSIAFRAGLT KEVGLSEKQL  60
QVWFTHRRRK DRRDGIEHDQ LTLHGNHNKS EMQSDEPELV KDTQVNLNGR EDVCPKDQYP  120
IATLQDQDDD NDDDVIIIEG WNVMNGSNGK DPKPQDEKMQ KPNTVTRGEI MPQPKEHTKM  180
LQLWRPNPEP EAFISTEANE LVAIAAVEMQ LCEPLREDGP PLGIEFDTLP PGAFQDFTRT  240
KGLHRLELKK GSVQMVTGRA AVPQKSKDLV FLKNKKRQLG DLYGKRLSAQ LSVLQGRFE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16673RRRKDRRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.11e-16homeobox-1